dryerventcleaningfriendswood.com valuation and analysis
Robots.txt Information
| Robot | Path | Permission |
| GoogleBot | / | ✔ |
| BingBot | / | ✔ |
| BaiduSpider | / | ✔ |
| YandexBot | / | ✔ |
User-agent: * Allow: / Disallow: | ||
Meta Tags
| Title | Dryer Vent Cleaning Friendswood TX | Clean Clogged |
| Description | Dryer Vent Cleaning Friendswood Texas know exactly where to look for hard to find lint. We will make sure that inside and around your dryer is fully lint |
| Keywords | vent cleaning, vent cleaners, prevent fires, remove lint, cleaning vents, dryer vent, lint removal |
Server Information
| WebSite | |
| Host IP | 108.167.141.132 |
| Location | United States |
Related Websites
| Site | Rank |
More to Explore
dryerventcleaningfriendswood.com Valuation
|
US$923,687
Last updated: 2023-05-08 22:03:33
dryerventcleaningfriendswood.com has Semrush global rank of 11,458,765. dryerventcleaningfriendswood.com has an estimated worth of US$ 923,687, based on its estimated Ads revenue. dryerventcleaningfriendswood.com receives approximately 106,580 unique visitors each day. Its web server is located in United States, with IP address 108.167.141.132. According to SiteAdvisor, dryerventcleaningfriendswood.com is safe to visit. |
Traffic & Worth Estimates
| Purchase/Sale Value | US$923,687 |
| Daily Ads Revenue | US$853 |
| Monthly Ads Revenue | US$25,580 |
| Yearly Ads Revenue | US$306,949 |
| Daily Unique Visitors | 7,106 |
| Note: All traffic and earnings values are estimates. | |
DNS Records
| Host | Type | TTL | Data |
| dryerventcleaningfriendswood.com. 7199 IN A | A | IP: 108.167.141.132 | |
| dryerventcleaningfriendswood.com. 86400 | NS | NS Record: ns8338.hostgator.com. | |
| dryerventcleaningfriendswood.com. 86400 | NS | NS Record: ns8337.hostgator.com. | |
| dryerventcleaningfriendswood.com. 14400 | MX | MX Record: 0 mail.dryerventcleaningfriendswood.com. | |
| dryerventcleaningfriendswood.com. 14400 | TXT | TXT Record: v=spf1 a mx include:websitewelcome.com ~all |
HtmlToTextCheckTime:2023-05-08 22:03:33
| Dryer Vent Cleaning Friendswood TX You use your dryer each week or more and it’s a vital that your dryer is working in a good condition. What dryer vent cleaning Friendswood TX does for you is make sure that your dryer is always working properly with a dryer vent cleaning. By having your dryer vents cleaned by a professional we are making sure that you will fire proof for your dryer and home. Dryer fires can cause so much damage in your home and can even cause bodily harm. Dryer fires come from lint being stored inside your dryer over time and not being cleaned out properly. Over time this can cause the lint to overheat and start a fire. This is an easily avoidable problem by calling our professionals. Our technicians know exactly where to look for hard to find lint that can build up over time. Why You Need Vent Cleaning Services Millions of homeowner’s neglect to understand that something so simple as dryer vent cleaning could save their home from a dryer fire hazard and much worse. |
HTTP Headers
HTTP/1.1 200 OK Date: Sat, 30 Oct 2021 18:52:44 GMT Server: Apache Upgrade: h2,h2c Connection: Upgrade Last-Modified: Sun, 15 Nov 2020 08:25:00 GMT Accept-Ranges: bytes Content-Length: 12305 Cache-Control: max-age=604800 Expires: Sat, 06 Nov 2021 18:52:44 GMT Vary: Accept-Encoding,User-Agent Content-Type: text/html; charset=utf-8 |
dryerventcleaningfriendswood.com Whois Information
Domain Name: DRYERVENTCLEANINGFRIENDSWOOD.COM Registry Domain ID: 2033079204_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.godaddy.com Registrar URL: http://www.godaddy.com Updated Date: 2021-06-03T14:48:50Z Creation Date: 2016-06-02T12:35:00Z Registry Expiry Date: 2023-06-02T12:35:00Z Registrar: GoDaddy.com, LLC Registrar IANA ID: 146 Registrar Abuse Contact Email: abuse@godaddy.com Registrar Abuse Contact Phone: 480-624-2505 Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited Name Server: NS8337.HOSTGATOR.COM Name Server: NS8338.HOSTGATOR.COM DNSSEC: unsigned >>> Last update of whois database: 2021-09-18T05:11:06Z <<< |